Protein Info for RR42_RS33580 in Cupriavidus basilensis FW507-4G11

Annotation: 3-hydroxyacyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF03446: NAD_binding_2" amino acids 3 to 110 (108 residues), 26.3 bits, see alignment E=1.4e-09 PF01210: NAD_Gly3P_dh_N" amino acids 3 to 106 (104 residues), 25.8 bits, see alignment E=1.9e-09 PF02737: 3HCDH_N" amino acids 3 to 175 (173 residues), 163.9 bits, see alignment E=7.9e-52 PF00725: 3HCDH" amino acids 178 to 276 (99 residues), 70.1 bits, see alignment E=3.9e-23

Best Hits

KEGG orthology group: K00074, 3-hydroxybutyryl-CoA dehydrogenase [EC: 1.1.1.157] (inferred from 52% identity to gag:Glaag_2469)

Predicted SEED Role

"3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Polyhydroxybutyrate metabolism (EC 1.1.1.157)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.157

Use Curated BLAST to search for 1.1.1.157

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YP41 at UniProt or InterPro

Protein Sequence (304 amino acids)

>RR42_RS33580 3-hydroxyacyl-CoA dehydrogenase (Cupriavidus basilensis FW507-4G11)
MCIGVVGAGLMGHGIAQVFLEDGRFDVSVYDAAPGLIETVQERIASNLKALGRPAVSFAK
LKLSDNISEALSGCQIVFEAVPEKLEIKHHVMRQIEAVVSGECIIASNTSVIPIGHIGEA
VSKKDRLVGTHWWNPPFLIPLVEVVQATATNQQVVERTISLLESVGKVAVHVRKDVPGFV
GNRLQHALWREAIALVSQGICDARTVDLVVKNSFGLRLPVLGPLENADLVGLDLTQDIHA
VILPTLDSTSWPNRIVTNSVRDGNLGMKSGKGFYEWTHSSAQDVREQLLAYLAAALKERG
DAQA