Protein Info for RR42_RS33545 in Cupriavidus basilensis FW507-4G11

Annotation: peptidase M50

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 689 transmembrane" amino acids 101 to 109 (9 residues), see Phobius details amino acids 134 to 151 (18 residues), see Phobius details amino acids 162 to 180 (19 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 334 to 358 (25 residues), see Phobius details amino acids 364 to 384 (21 residues), see Phobius details amino acids 405 to 423 (19 residues), see Phobius details PF13533: Biotin_lipoyl_2" amino acids 441 to 483 (43 residues), 24.9 bits, see alignment 2.1e-09 PF13437: HlyD_3" amino acids 528 to 587 (60 residues), 27.3 bits, see alignment 7.7e-10

Best Hits

KEGG orthology group: None (inferred from 58% identity to bgd:bgla_2g13880)

Predicted SEED Role

"Peptidase M50"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YUI0 at UniProt or InterPro

Protein Sequence (689 amino acids)

>RR42_RS33545 peptidase M50 (Cupriavidus basilensis FW507-4G11)
MHPGPAEPSGAPTWTLHDPAANKFYQLSWPAFEILSRWPLGEARALLDAVNRETTLTVGE
DELEAVVQLLHRHNLLLAWRAQDSARLGRIAGAHRVSKAMWLLKHYLFFRVPLVRPMPML
QRCAPWVEWAFKPRFWWGVGLVALLGLYLVSRRWDEFTHTFASYAGLQGLLGIGLALSLA
KVLHELGHAATAYRYGCRVPTMGVAFLVMWPVLYTDTNEAWKLMRREDRLKIGAAGMLSE
LALAAFATVAWSFLPDGPLRAGAFMLATSTWLLTLAINASPFMRFDGYFLLADWLNMPNL
HDRAFAMARWWLRERLFGFADPAPESFSASRRRFLIVFAILTWLYRLGLFFGIALTVYHL
FFKTLGLALLAIELGVFIVMPVVREVLAWRHRRADIHWNAQTRRAVVLLGVLLAVVVIPW
GGTIRAPAVLSASQSQSLYAAQPGYVSGGAVQAGQTVAAGQLLAQLVSPELDFRLAAAQA
QAQQLRWQMEQQPFATKLREEGDVLRRRWAAAQAEVAGLAEERKRMEVRAPFAGRVVDAN
LFLADGAWLARGEPLYHIVGQGSELKAEAFIGEQDHAALTAGSSGVFVANLPEFGSVRCT
AAQTDQVNVAGLEQRTLASLYGGPIAVTRSQHNGLAPTTAIFRVRLSHCDSLPLSRELPG
TVLLARQRHSLAGDAWTALLGLMQRERGL