Protein Info for RR42_RS33460 in Cupriavidus basilensis FW507-4G11

Annotation: glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08327: AHSA1
  • amino acids 16 to 146 (131 residues), 99.7 bits, E=5.2e-32
• PF13417: GST_N_3
  • amino acids 159 to 228 (70 residues), 58.2 bits, E=2.9e-19
• PF02798: GST_N
  • amino acids 161 to 222 (62 residues), 33.5 bits, E=1.5e-11
• PF13409: GST_N_2
  • amino acids 163 to 223 (61 residues), 51.2 bits, E=5.3e-17
• PF00043: GST_C
  • amino acids 270 to 342 (73 residues), 42.3 bits, E=2.5e-14
• PF14497: GST_C_3
  • amino acids 272 to 352 (81 residues), 29.5 bits, E=2.5e-10
• PF13410: GST_C_2
  • amino acids 279 to 342 (64 residues), 29.2 bits, E=2.8e-10

Best Hits

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 79% identity to rso:RSc0992)

Predicted SEED Role

"Putative glutathione s-transferase transmembrane protein (EC 2.5.1.18)" (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• pentachlorophenol degradation (5/10 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• gliotoxin biosynthesis (2/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

See A0A0C4YMJ3 at UniProt or InterPro

Protein Sequence (361 amino acids)

>RR42_RS33460 glutathione S-transferase (Cupriavidus basilensis FW507-4G11)
MTQAATFHLEMDRFIRAPREKVFDAFTSQAALSEWHCPRGMHVLEASADARVGGRYRIVM
GGRDGARHIVGGEYQAIDRADFLAYTWFWETGPMPPQIKTLIEVTLTAKDGGTHLHMRHS
GFPEAGQRDSHMGGWQSVFNRLSDFLDPEGSAGSVTVIGDPRSSYCRTVRMALAEKGVAY
KLQPVPPHSPEVLAHSPFGRIPVLSDGPLSFYETRAILAYIEEAFEGPSLLARQAGAIGH
ARCEQWISLINCHAYDAMVRRYVLQYIFPKGENGQPERAVIDAALPEIATQLGAFDEAYG
NRDYLVGTAMSMADLFLAPILAYVGMFPEGAALLEKCPNVRRAQAVMRERPSFVATQPQM
G