Protein Info for RR42_RS33390 in Cupriavidus basilensis FW507-4G11

Annotation: beta-Ala-Xaa dipeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 573 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01887: putative dipeptidase" amino acids 97 to 561 (465 residues), 262.2 bits, see alignment E=5.8e-82 PF04389: Peptidase_M28" amino acids 161 to 261 (101 residues), 23.2 bits, see alignment E=7.5e-09 PF01546: Peptidase_M20" amino acids 163 to 563 (401 residues), 79.7 bits, see alignment E=4.5e-26

Best Hits

KEGG orthology group: None (inferred from 76% identity to rpf:Rpic12D_1237)

Predicted SEED Role

"Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YQC9 at UniProt or InterPro

Protein Sequence (573 amino acids)

>RR42_RS33390 beta-Ala-Xaa dipeptidase (Cupriavidus basilensis FW507-4G11)
MKRSTLLASLALLTLAMGQPAVADTLKKPGLDALAAAAQASPPTDFNAFLSAAAKADPSL
AGSVAAYQKHASLHGDDLTNIGRLLGLYNRIHNHQAVIGAIERMVALRTVRDDKIPQHEN
PAIIAFGNLVEGMAKDFGLTFRNVDNRVFEVTLPGTGKEEFGLLTHADVVPAVADEWVLD
DGTRLDPFKVTRVGDFLYGRGTIDDKGSIATVLYAMKTVKESGLKLNRTIRLMIETTEET
GGDGMKYYRQHTKLPEYNIVLDSKYPAVVAEKGSGSLKVFFPVQATDGDATAIVGMSGAA
SANAVPQTASAQLKGGDLNAARARLEAARAAFIEKYAPQGKFAIDITQRADSLEVKVTGS
SAHGSRPEEGVNPLPRLTLFLRESGIALADNHYARAAKYLDDLYATGYLGEKMGVAYKDD
FMGPLTLSPNLVQEKDGRLEVTTNVRMPRGNTPQALSKAVADKINAWAAANHATVTISHD
QGDWMARDPKGAWLSTLLNIFGDTTGLEAKPVPTAGSTTAKLMPNAINFGPAMPGKKYTA
HNAKEYKEVVDLDLDMQMFTEMLIRIGDLKTMQ