Protein Info for RR42_RS33355 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 37 to 56 (20 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 130 to 155 (26 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details PF01169: GDT1" amino acids 6 to 81 (76 residues), 74.5 bits, see alignment E=3.5e-25 amino acids 105 to 179 (75 residues), 82.3 bits, see alignment E=1.3e-27

Best Hits

Swiss-Prot: 54% identical to MNEA_VIBC3: Putative manganese exporter (mneA) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: None (inferred from 71% identity to dvm:DvMF_1438)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YER1 at UniProt or InterPro

Protein Sequence (194 amino acids)

>RR42_RS33355 membrane protein (Cupriavidus basilensis FW507-4G11)
MEALIASFGMVALAEMGDKTQLLSFLLASRFLGKQWSIIAGIFVATIFNHLFAAALGDWA
ASHVSPDVTRWVLGIAFLAFAAWALIPDKLDDEGNNGKRAGAFATTVVAFFLAEMGDKTQ
FATIALGAQYANLGMVVVGTTLGMMAANVPAVLLGERLTRIIPLSKMRFVAAALFAIFGI
LILFKVSFGLNLGI