Protein Info for RR42_RS33250 in Cupriavidus basilensis FW507-4G11

Annotation: tyrosine protein kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 751 transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 445 to 465 (21 residues), see Phobius details TIGR01005: exopolysaccharide transport protein family" amino acids 15 to 744 (730 residues), 807.8 bits, see alignment E=9.3e-247 PF02706: Wzz" amino acids 16 to 108 (93 residues), 73.5 bits, see alignment E=6.3e-24 PF13807: GNVR" amino acids 388 to 468 (81 residues), 100 bits, see alignment E=2.5e-32 TIGR01007: capsular exopolysaccharide family" amino acids 525 to 729 (205 residues), 164.7 bits, see alignment E=2e-52 PF06564: CBP_BcsQ" amino acids 546 to 685 (140 residues), 23.7 bits, see alignment E=1.4e-08 PF01656: CbiA" amino acids 548 to 718 (171 residues), 33.5 bits, see alignment E=1.7e-11 PF10609: ParA" amino acids 554 to 713 (160 residues), 32.2 bits, see alignment E=3.4e-11 PF13614: AAA_31" amino acids 554 to 674 (121 residues), 56.1 bits, see alignment E=2.2e-18

Best Hits

Swiss-Prot: 69% identical to EPSB_RALSL: Putative tyrosine-protein kinase EpsB (epsB) from Ralstonia solanacearum

KEGG orthology group: K00903, protein-tyrosine kinase [EC: 2.7.10.-] (inferred from 72% identity to cti:RALTA_A1638)

Predicted SEED Role

"Tyrosine-protein kinase Wzc (EC 2.7.10.2)" in subsystem Colanic acid biosynthesis (EC 2.7.10.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.10.-, 2.7.10.2

Use Curated BLAST to search for 2.7.10.- or 2.7.10.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YQ99 at UniProt or InterPro

Protein Sequence (751 amino acids)

>RR42_RS33250 tyrosine protein kinase (Cupriavidus basilensis FW507-4G11)
MNQNPPTVPVAGPPEDEIDLVHYLDVLLANRWLIALIAAVVLTLGLAYSFLASPVYQADI
LVQVEDSPNSAKSLLGDVSSIFDVKAEATAEIEILRSRMVVGKAVDNLHLYISAAPKYFP
FVGSWIARRSKGLSEPGLFGFGGYVWAGEAIKVELFDVPEVLEGAPFKLVALGAGRFRLE
QESLDRSLEGRVGEVLQATQEVGTLNILVSDLKAKPGAVFNVVRASRLQTLTRLQAQLNI
AEKGKQSGIIGASLDGTNPALTASILNNLGEEYVAQNIKRKAAEAEKSLVFLGDLLPQLK
TELERAEVKYNEMRNKRGTFNLSAEGSALLQESVTAETALLELKQKRLELLTRFTANHPG
VQALDQQIATLTAKTGGLTARMGTLPNVEQDTLRLMRDVQVNNDLYVGLLNNMQQLKLVK
AGKVGNVRLLDNAPIPEAPIKPKKAFVIGISGIAGILLGIIAAFVRNALYGGITDPQDIE
QHTGLNVYATVPLSATQAILTEEIRQRKPGKFLLADRNPNEPSIESLRSLRTALQFAMLD
ADNNRVLLTGPTPGVGKSFVSANLALVMATGGKRVLLVDADMRKGYLNQYFGKDRQRGLS
DVLVGKIGFEEAVHKQVFENLDFLSTGVLPPNPAELLLNERMVKLLQELGEHYDLVLIDT
PPVLAVSDTAILAARCGTVFLVTRFEKTTIGEISESAKQLRQANADVNGVVFNGLDANAY
RYGYGSKYGRYRYAYYGYASEEAVQRPPRSV