Protein Info for RR42_RS33240 in Cupriavidus basilensis FW507-4G11

Annotation: GDP-L-fucose synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 PF04321: RmlD_sub_bind" amino acids 6 to 75 (70 residues), 27.8 bits, see alignment E=2e-10 PF01370: Epimerase" amino acids 7 to 238 (232 residues), 224.7 bits, see alignment E=1.8e-70 PF16363: GDP_Man_Dehyd" amino acids 39 to 298 (260 residues), 54.6 bits, see alignment E=1.9e-18

Best Hits

Swiss-Prot: 60% identical to FCL2_ARATH: Putative GDP-L-fucose synthase 2 (GER2) from Arabidopsis thaliana

KEGG orthology group: K02377, GDP-L-fucose synthase [EC: 1.1.1.271] (inferred from 85% identity to lch:Lcho_0624)

MetaCyc: 62% identical to GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase (Arabidopsis thaliana col)
GDP-L-fucose synthase. [EC: 1.1.1.271]

Predicted SEED Role

"GDP-L-fucose synthetase (EC 1.1.1.271)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 1.1.1.271)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.271

Use Curated BLAST to search for 1.1.1.271

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YEP6 at UniProt or InterPro

Protein Sequence (310 amino acids)

>RR42_RS33240 GDP-L-fucose synthase (Cupriavidus basilensis FW507-4G11)
MDKTAKIFVTGHRGMVGSAIVRRLREGGYTNVLTRTHAELDLLDQRAVHAFLSSEGPEYI
FIAAAKVGGIQANNLYRADFLYQNLLIEANIIHGAHLAGVQRLMFLGSSCIYPRDCPQPI
KEEYLLSGPLEPTNEPYAIAKIAGIKLCESYNRQFGRQYVGVMPTNLYGPNDNYDLANSH
VLPALIRKAHEAKLRSDDEYVVWGTGTPRREFLYVDDLADACVHLAEQGYDGPLVNIGTG
KDLTIRELAETVMDVVGFRGRIVYDATKPDGTPRKLLDVSRLASLGWRARTTLADGVRLA
YDVAPFRQWA