Protein Info for RR42_RS33090 in Cupriavidus basilensis FW507-4G11

Annotation: fumarate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 TIGR00979: fumarate hydratase, class II" amino acids 4 to 461 (458 residues), 736.7 bits, see alignment E=4.9e-226 PF00206: Lyase_1" amino acids 12 to 344 (333 residues), 372.2 bits, see alignment E=2.4e-115 PF10415: FumaraseC_C" amino acids 410 to 463 (54 residues), 81 bits, see alignment 6.7e-27

Best Hits

Swiss-Prot: 79% identical to FUMC_DEIRA: Fumarate hydratase class II (fumC) from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

KEGG orthology group: K01679, fumarate hydratase, class II [EC: 4.2.1.2] (inferred from 79% identity to glo:Glov_1071)

MetaCyc: 60% identical to fumarase C (Escherichia coli K-12 substr. MG1655)
Fumarate hydratase. [EC: 4.2.1.2]

Predicted SEED Role

"Fumarate hydratase class II (EC 4.2.1.2)" in subsystem TCA Cycle (EC 4.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.2

Use Curated BLAST to search for 4.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YU98 at UniProt or InterPro

Protein Sequence (467 amino acids)

>RR42_RS33090 fumarate hydratase (Cupriavidus basilensis FW507-4G11)
MPAFRSETDSMGAIDVPADRYWGAQTQRSTINFPIGVSRFRWQRPVIRALGILKRAAAEA
NAELGELPPDIGRLIVQAADEVISGKLDEHFPLVVFQTGSGTQSNMNANEVISNRAIEIA
GGELGSKKPVHSNDHVNRGQSSNDTFPTAMHIAVVEQIHTKLLPAVGALRDTLAAKAQAY
QDIVKTGRTHLQDATPITLGQEISAWVAQIDFGLNAVKTAEPGLLELAIGGTAVGTGLNA
HPQFGARAAAYIAALTGHPFVDAPNKFFALSAHDALVQTSAALRTLSGGLMKMANDVRWL
ASGPRCGIGELNIPENEPGSSIMPGKVNPTQCEAMTMVCAQVFGNDATVAFAGSQGNFQL
NVYKPVMVHNVLESIELIADACLAFNDHCALGIEPNLPKIAENLDKNLMLVTALNRHIGY
DKAAAIAKKAHKEGLTLKAAALALGYLTEDEYARWIVPIEMTHPNKD