Protein Info for RR42_RS32950 in Cupriavidus basilensis FW507-4G11

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00561: Abhydrolase_1
  • amino acids 48 to 269 (222 residues), 83.9 bits, E=1.5e-27
• PF12697: Abhydrolase_6
  • amino acids 49 to 276 (228 residues), 70.1 bits, E=4.4e-23

Best Hits

KEGG orthology group: None (inferred from 53% identity to reh:H16_B1437)

Predicted SEED Role

"2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (EC 3.7.1.-)" in subsystem Biphenyl Degradation or Central meta-cleavage pathway of aromatic compound degradation or carbazol degradation cluster (EC 3.7.1.-)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Caprolactam degradation
• Ethylbenzene degradation
• Inositol phosphate metabolism
• Limonene and pinene degradation
• Nicotinate and nicotinamide metabolism
• Phenylalanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.7.1.-

Use Curated BLAST to search for 3.7.1.-

Sequence Analysis Tools

See A0A0C4YU50 at UniProt or InterPro

Protein Sequence (284 amino acids)

>RR42_RS32950 alpha/beta hydrolase (Cupriavidus basilensis FW507-4G11)
MTQISSKTPVASIQPEAQAAALLQQSERIVTDADGCRMVWRRFGEGHPVVLLHGGHGSWL
HWVRNIEALAAHRAVWAPDMPGFGESDDIASDLSVMTGTLVRGIRQLPGCDKALSLVGFS
FGGLVAANVAASLGTVCRLALMGSGGHGGIRRQQRALVDWRKAGDAEALAVAMRYNLEAF
MLADPARIDAMAMYAHTESCRLTRFRSKNISRAGDLRCALDRFGGEVLLAWGEHDVTADP
VRAIAAMTQDSPRREGRVIANAGHWVQYEAHAPVNALLDGWLPT