Protein Info for RR42_RS32895 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 156 to 185 (30 residues), see Phobius details amino acids 211 to 234 (24 residues), see Phobius details amino acids 244 to 262 (19 residues), see Phobius details amino acids 269 to 284 (16 residues), see Phobius details amino acids 292 to 312 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 45 to 309 (265 residues), 133.1 bits, see alignment E=5.4e-43

Best Hits

Swiss-Prot: 39% identical to RBSC_ECOL6: Ribose import permease protein RbsC (rbsC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 79% identity to reu:Reut_B4134)

MetaCyc: 39% identical to ribose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"Sugar ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YNN3 at UniProt or InterPro

Protein Sequence (318 amino acids)

>RR42_RS32895 ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MPDTNALPRPLGLSIGKVPGSVWVLLLLSLGFSVTGPGFLSVENLLNIGAQSTILLLIAL
PMTLIIMTEGLDLSMGAVLTLCGVVLAMVMVATESLPLALGAALLTGLAFGLLNGALVSW
LEIPPFVATLGTLGVAQGLALVATDGQSVTGIGEAIPLIYAGQLLGVPLPIWIAAVFYGL
FHWLLYHTRFGAYVFALGGNREALKFSGVRINVYLIAVYALGGLMAGVAALLLTARMNAG
HPTAAIGLEFDAIAAVAVGGTTFDRGNGWLPGTVLGVLAVGVLRNGLNLVGVPSSVQVAA
IGLLVLVVLLIESFKGKA