Protein Info for RR42_RS32890 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 18 to 41 (24 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details amino acids 272 to 289 (18 residues), see Phobius details amino acids 295 to 313 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 43 to 307 (265 residues), 134.9 bits, see alignment E=1.5e-43

Best Hits

Swiss-Prot: 40% identical to RBSC_BACSU: Ribose import permease protein RbsC (rbsC) from Bacillus subtilis (strain 168)

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 87% identity to reu:Reut_B4135)

MetaCyc: 32% identical to Autoinducer-2 ABC transporter membrane subunit LsrC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-454 [EC: 7.6.2.13]

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YQ12 at UniProt or InterPro

Protein Sequence (322 amino acids)

>RR42_RS32890 ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MNTATLFPPLSADARSFAYRLFALGLLCLLLAVASDAFLTLGNILNVLRQASLLFLLASG
VTLVILTGGLDLSVGANVAMSACVAATVMKATGSTMLGVGAGLGTGALIGLANGLLVAML
RIPPFIATYGMLWVLHGVTYWFMAGETIHGFPPAFRAIGSGYLWGVPIPVYLMLVFLVAG
TAMSQKTTYGQEIYAIGANPVAARLSGVPVRRRLVLVYLVSGAMAGIASLVFLARLNSAE
GDIGEALTLPAIAAVLIGGTSLFGGVGRVSGTLVGAIILTLVLNGMNLLTVSANWQPLVT
GVIVVLAVFLDTLSRKRLGVRS