Protein Info for RR42_RS32840 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 788 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 265 to 287 (23 residues), see Phobius details amino acids 315 to 337 (23 residues), see Phobius details amino acids 362 to 386 (25 residues), see Phobius details amino acids 434 to 455 (22 residues), see Phobius details amino acids 656 to 676 (21 residues), see Phobius details amino acids 713 to 736 (24 residues), see Phobius details amino acids 752 to 772 (21 residues), see Phobius details PF02687: FtsX" amino acids 271 to 390 (120 residues), 56.8 bits, see alignment E=1.1e-19 amino acids 662 to 779 (118 residues), 52.7 bits, see alignment E=2e-18

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 67% identity to reu:Reut_B5172)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YM39 at UniProt or InterPro

Protein Sequence (788 amino acids)

>RR42_RS32840 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MVTALWKMLGRDLWRLRGQVIAAALVVACGIAVLVGMYGAWQSLAIAQDRYYTGHRFADV
FANVKRAPLGMVEQIRALPGVRGVETRIVRDVTADVPGFSEPATLRLVSLPASGVPVVNA
LFLLRGHFPNPAREDEVVASAVFAAANGLEVGSRITAILNGRSRNLAIVGIGMSPEYVYE
VGQGMVFPDNRRFGVVWVGREAVASAFGMEGAFNDIALTLDAGVTARQLIDPLDRLLARY
GSLGAYGREDQLSNRFLSDELAEIGITATYVPVLFLAVSSFLLYTLLSRLVTMQRAEIGL
LKAFGYGGRTVAFQYLRFGLATVSIGVAAGIPAGLYFETLMVDLYRQYFHFPNLQATISP
RALIVAVLASVAAAIVGAGAAVLRAARLPPAEAMRPELPAGFRASLLDRAGVLRAMPIQL
RLIVRNLARRPGKAMLSTTGIALAVGLMVVGRFGLDGVKQILDLQFGQVQHDDVTLFFNE
AQPAAAAFDVVQLPGVMRAEGFRMTPVWLRHGHRAKRVELTGLDAGADLREVVGYTGGRQ
RVSSDGLVVSAKLAETLHIGIGDRVEAELLEGRRNVITLPVVATVDDLLGISAYIERHAL
SRQLGESPAISGLYLRIDTLKEQQLYARLKRLPAISSVIVRSAVLESIGSTLDRTFVISS
LVLAGFASVIVAGVVYNNIRIALSERGNELASLRVLGFSQGEVATILIGEQALLTAAALP
LGIAVGYGLCALLVPVFDRDAFRMPLALERATLFFAMLPAACAALAAGLLVLRRLRHLDL
VAVLKTRE