Protein Info for RR42_RS32620 in Cupriavidus basilensis FW507-4G11

Annotation: chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 602 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 275 to 301 (27 residues), see Phobius details PF02743: dCache_1" amino acids 68 to 260 (193 residues), 79.7 bits, see alignment E=3.6e-26 PF00672: HAMP" amino acids 302 to 348 (47 residues), 43.5 bits, see alignment 4.9e-15 PF00015: MCPsignal" amino acids 414 to 567 (154 residues), 164.4 bits, see alignment E=3.5e-52

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 73% identity to reu:Reut_A0036)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YTX3 at UniProt or InterPro

Protein Sequence (602 amino acids)

>RR42_RS32620 chemotaxis protein (Cupriavidus basilensis FW507-4G11)
MLSSLRARIVALSVAIVVVALIANAVINHVVASSYSDDAIDSNLAAVQNGHVGAIADWVA
SHMQMIDSLQDAATQSDTNAAIAALKQVSSAGGFVMTYIGFPDKSHRFSDTEGLRPNYDP
TSRPWYKQAVAAGKPVVTPPYVAASSGKLVVTFAVPILRDGALKGVVAGDVSMDSVIANI
KAIHPTPASFGVLVTKDGKIVAHQDDKLTLKPVTDLMPALALDKLATLEGAKAPLQVEVD
NAPKLLRARSVPGTDWIAVIALDQGEATAGMRSMLMASVFVLIVIACVAAAIVAGVTAVS
FRRLSVIRDAMRDIGSGDGDLTRRLPANGSDEVAQIAQAFNAFAEKLVSVMRQIRDASAS
VHAAADEIAAGNIDLSRRTESAAASLEETAASMEQITATVSQSAMSAKQADASAIAASQV
AGNGGAAIGEAIQTMSEIERASVKVSDIIGVIEGIAFQTNILALNAAVEAARAGEQGRGF
AVVAGEVRGLAQRSSQAAKEIKTLIETTVDSVVSGSGQVRRAGDTMNAIVGNVDKVTSII
SEITNAAQEQTRGIQEVNLAVSQLDQMVQQNAALVEESTAAAEALQGQAGALAGVVGQFR
LG