Protein Info for RR42_RS32600 in Cupriavidus basilensis FW507-4G11

Annotation: cytochrome O ubiquinol oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01433: ubiquinol oxidase, subunit II
  • amino acids 15 to 237 (223 residues), 373.4 bits, E=1.7e-116
• PF00116: COX2
  • amino acids 148 to 222 (75 residues), 25.4 bits, E=1.2e-09
• PF06481: COX_ARM
  • amino acids 237 to 281 (45 residues), 64.2 bits, 7.7e-22

Best Hits

Swiss-Prot: 63% identical to CYOA_PSEPU: Cytochrome bo(3) ubiquinol oxidase subunit 2 (cyoA) from Pseudomonas putida

KEGG orthology group: K02297, cytochrome o ubiquinol oxidase subunit II [EC: 1.10.3.-] (inferred from 76% identity to reu:Reut_A0982)

MetaCyc: 63% identical to cytochrome bo terminal oxidase subunit II (Pseudomonas putida KT2440)
RXN0-5268 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• NADH to cytochrome bo oxidase electron transfer II (2/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (2/2 steps found)
• proline to cytochrome bo oxidase electron transfer (2/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (2/2 steps found)
• D-lactate to cytochrome bo oxidase electron transfer (1/2 steps found)
• pyruvate to cytochrome bo oxidase electron transfer (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

See A0A0C4YTW8 at UniProt or InterPro

Protein Sequence (322 amino acids)

>RR42_RS32600 cytochrome O ubiquinol oxidase subunit II (Cupriavidus basilensis FW507-4G11)
MKIPKLPRWTRLMPCAALLLLAGCNMAVLDPKGQIGADVKNIILIATWLMLLVVVPVIVL
VFTFAWKYRASNKSARYEPDWSHSTGIEVVVWLIPCLIILVLGIITWKSSHDLDPYKPIE
SNVKPITIEAVALNWKWLFIYPDLGIATVNEIAFPVNTPVNFKITSDSIMNSFFIPQLGS
QVYAMAGMETKLHLIASETGAFDGMSANYSGGGFSGMKFKARSVSNFDFEAWVKQVRASS
SQLTLADYSALAKPSEANPVALYAKVDPQLYHGILHKYMDGAGGAIAGNGTSFGPVCTSR
NTLGVSQVSMAAPATPAPGSNS