Protein Info for RR42_RS32495 in Cupriavidus basilensis FW507-4G11

Annotation: shikimate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01202: SKI
  • amino acids 1 to 157 (157 residues), 180.9 bits, E=9.7e-58

Best Hits

Swiss-Prot: 64% identical to AROK_RALSO: Shikimate kinase (aroK) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00891, shikimate kinase [EC: 2.7.1.71] (inferred from 74% identity to rme:Rmet_4010)

Predicted SEED Role

"Shikimate kinase I (EC 2.7.1.71)" in subsystem Benzoate transport and degradation cluster or Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.7.1.71)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• superpathway of chorismate metabolism (45/59 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.71

Use Curated BLAST to search for 2.7.1.71

Sequence Analysis Tools

See A0A0C4YND8 at UniProt or InterPro

Protein Sequence (170 amino acids)

>RR42_RS32495 shikimate kinase (Cupriavidus basilensis FW507-4G11)
MGAGKTTIGRTVARRLGLPFFDSDHEIEARCGVRIPTIFELEGEEGFRERESRVLDELSQ
RRGIVMATGGGAVLRPENREMLRSRGCVIYLCASPAELWHRTRRNRNRPLLQVANPRATL
EALFQVRDPLYRETAHLIMPPHGDSVANAAGRVLERLGLSERVLPPQVDP