Protein Info for RR42_RS31900 in Cupriavidus basilensis FW507-4G11

Annotation: short-chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 30% identical to TPRL3_ERYCB: Tropinone reductase-like 3 from Erythroxylum coca

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 92% identity to reu:Reut_A1570)

MetaCyc: 61% identical to 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl-CoA reductase (Mycobacterium tuberculosis H37Rv)
3-beta-hydroxy-Delta(5)-steroid dehydrogenase. [EC: 1.1.1.145]; 1.1.1.- [EC: 1.1.1.145]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

superpathway of fatty acids biosynthesis (E. coli) (50/53 steps found)
superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
superpathway of unsaturated fatty acids biosynthesis (E. coli) (19/20 steps found)
oleate biosynthesis IV (anaerobic) (13/14 steps found)
palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (9/9 steps found)
superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
biotin biosynthesis I (13/15 steps found)
cis-vaccenate biosynthesis (5/5 steps found)
fatty acid elongation -- saturated (5/5 steps found)
gondoate biosynthesis (anaerobic) (4/4 steps found)
8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
(5Z)-dodecenoate biosynthesis I (5/6 steps found)
stearate biosynthesis II (bacteria and plants) (5/6 steps found)
8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
palmitate biosynthesis III (21/29 steps found)
(5Z)-dodecenoate biosynthesis II (4/6 steps found)
stearate biosynthesis IV (4/6 steps found)
anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
progesterone biosynthesis (1/2 steps found)
tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
androstenedione degradation I (aerobic) (16/25 steps found)
petroselinate biosynthesis (2/6 steps found)
superpathway of testosterone and androsterone degradation (17/28 steps found)
androgen biosynthesis (1/6 steps found)
2-allylmalonyl-CoA biosynthesis (2/8 steps found)
streptorubin B biosynthesis (20/34 steps found)
backdoor pathway of androgen biosynthesis (2/11 steps found)
androstenedione degradation II (anaerobic) (10/27 steps found)
superpathway of cholesterol degradation I (cholesterol oxidase) (20/42 steps found)
sitosterol degradation to androstenedione (2/18 steps found)
cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (4/22 steps found)
11-oxyandrogens biosynthesis (2/20 steps found)
superpathway of cholesterol degradation II (cholesterol dehydrogenase) (20/47 steps found)
cholesterol degradation to androstenedione III (anaerobic) (2/22 steps found)
superpathway of steroid hormone biosynthesis (2/28 steps found)
superpathway of cholesterol degradation III (oxidase) (12/49 steps found)
mycolate biosynthesis (26/205 steps found)
superpathway of mycolate biosynthesis (27/239 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.145

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YTA9 at UniProt or InterPro

Protein Sequence (265 amino acids)

>RR42_RS31900 short-chain dehydrogenase (Cupriavidus basilensis FW507-4G11)
MAGTPIPPPAYVAGHQLLAGKSVLITAAAGAGIGFAAARRCAEEGCRALMISDIHEKRLD
EAVATLRAETGLQAIHGQLCDVSDQAQVRSLVAAAEEALGGTDVLINNAGLGGSRRIVEM
DDAEWSRVLDITLTGTFRMTRAMLPHMQARRRGVIVNNASVLGWRAQKEQAHYAAAKAGV
MALTRCSAVEAAEFGVRINAVAPSIALHDFLRKSAPAELLRELASREAFGRAAEVWEVAN
VMVFLASDYASYMTGEVLPVSSQRA