Protein Info for RR42_RS31900 in Cupriavidus basilensis FW507-4G11

Annotation: short-chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF00106: adh_short" amino acids 21 to 213 (193 residues), 167.1 bits, see alignment E=5.4e-53 PF08659: KR" amino acids 23 to 185 (163 residues), 45.7 bits, see alignment E=1.1e-15 PF13561: adh_short_C2" amino acids 28 to 260 (233 residues), 186.5 bits, see alignment E=9.4e-59

Best Hits

Swiss-Prot: 30% identical to TPRL3_ERYCB: Tropinone reductase-like 3 from Erythroxylum coca

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 92% identity to reu:Reut_A1570)

MetaCyc: 61% identical to 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl-CoA reductase (Mycobacterium tuberculosis H37Rv)
3-beta-hydroxy-Delta(5)-steroid dehydrogenase. [EC: 1.1.1.145]; 1.1.1.- [EC: 1.1.1.145]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.145

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YTA9 at UniProt or InterPro

Protein Sequence (265 amino acids)

>RR42_RS31900 short-chain dehydrogenase (Cupriavidus basilensis FW507-4G11)
MAGTPIPPPAYVAGHQLLAGKSVLITAAAGAGIGFAAARRCAEEGCRALMISDIHEKRLD
EAVATLRAETGLQAIHGQLCDVSDQAQVRSLVAAAEEALGGTDVLINNAGLGGSRRIVEM
DDAEWSRVLDITLTGTFRMTRAMLPHMQARRRGVIVNNASVLGWRAQKEQAHYAAAKAGV
MALTRCSAVEAAEFGVRINAVAPSIALHDFLRKSAPAELLRELASREAFGRAAEVWEVAN
VMVFLASDYASYMTGEVLPVSSQRA