Protein Info for RR42_RS31765 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 40 to 59 (20 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 95 to 112 (18 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 149 to 165 (17 residues), see Phobius details amino acids 177 to 199 (23 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details PF00892: EamA" amino acids 148 to 276 (129 residues), 56.7 bits, see alignment E=1.5e-19

Best Hits

Swiss-Prot: 49% identical to RHTA_ECOLI: Threonine/homoserine exporter RhtA (rhtA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 86% identity to cti:RALTA_B0617)

MetaCyc: 49% identical to L-threonine/L-homoserine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-242; TRANS-RXN0-0244

Predicted SEED Role

"Putative DMT superfamily metabolite efflux protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YDV8 at UniProt or InterPro

Protein Sequence (292 amino acids)

>RR42_RS31765 membrane protein (Cupriavidus basilensis FW507-4G11)
MNRLNQSATLIAVLALIGSMASLCVGTSFAKSLFAEVGAQGTTALRVSFSALILLCVWRP
WRMPLSLANARVIALYGAALGATNLLFYMSLRTVPLGLAIAIEFTGPLALAVSSSRRAID
FLWIAFAVAGLLLLLPLGENVATLDPVGIGYALAAGVGWALYIIFGQMAGNAHGGQATSL
GLTMASLVVLPFGLAHAGAAMFSPSLLVAGLAVGLLSSAIPYSLEMVALKRLPRRTFGIL
LSMEPAMGALAGLAFLHETLNTQQWLAIASIITASVGCTVTAGSRRRASAEA