Protein Info for RR42_RS31605 in Cupriavidus basilensis FW507-4G11

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 transmembrane" amino acids 53 to 73 (21 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details amino acids 226 to 243 (18 residues), see Phobius details amino acids 249 to 268 (20 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details amino acids 326 to 344 (19 residues), see Phobius details amino acids 356 to 377 (22 residues), see Phobius details amino acids 382 to 401 (20 residues), see Phobius details amino acids 412 to 444 (33 residues), see Phobius details amino acids 451 to 471 (21 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 51 to 432 (382 residues), 243.3 bits, see alignment E=1.8e-76

Best Hits

Swiss-Prot: 74% identical to GHXQ_ECOLI: Guanine/hypoxanthine permease GhxQ (ghxQ) from Escherichia coli (strain K12)

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 89% identity to reu:Reut_B4989)

MetaCyc: 74% identical to guanine/hypoxanthine transporter GhxQ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-562; TRANS-RXN0-578

Predicted SEED Role

"Xanthine/uracil permease family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YP43 at UniProt or InterPro

Protein Sequence (472 amino acids)

>RR42_RS31605 permease (Cupriavidus basilensis FW507-4G11)
MLEQPFPGHAAAPGTDAIEAKAIDAIASVQAKGLLDRYFQISERGSTGRRETLAGATTFM
AMVYSVFVVPGMLGKAGFDGSAVFVATCLTAAFGSLLMGVWAKLPIAIGCAISLTAFTAF
GLVLGQGLSPAVALGAIFLMGVVFTTISVTGVRSWILRNLPAGVAHGTGIGIGLFLLLIA
SNDVGLVIKNPGAGLPVALGKITAFPVVMSILGLAAIFGLERRRVPGGILLVIVAISALG
LAFDPAVKFTGVFALPALSAPGHASLIGAMDIKGALSLTVLPSVLALVMTAVFDATGTIR
AVAGQAGQLDAKGQIPNGGRALTTDSLSSIFSAFFGGAPAAAYIESSVGVAAGAKTGLAA
VVVGLLFLAVIFFSPLAGLVPSYATAPALMYVGLLMLSSVSKLHMDDMVDAMAGLVCAVF
IVLTCNIVTGIMLGFCTLVIGRIVAGEYRKLNVGTVAIALALAVFYGGGWAI