Protein Info for RR42_RS31275 in Cupriavidus basilensis FW507-4G11

Updated annotation (from data): Homogentisate 1,2-dioxygenase (EC 1.13.11.5)
Rationale: Specifically important for utilizing L-Phenylalanine. Automated validation from mutant phenotype: the predicted function (1.13.11.5) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: homogentisate 1,2-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 TIGR01015: homogentisate 1,2-dioxygenase" amino acids 22 to 444 (423 residues), 672.5 bits, see alignment E=1.1e-206 PF20510: HgmA_N" amino acids 23 to 290 (268 residues), 423 bits, see alignment E=5e-131 PF04209: HgmA_C" amino acids 291 to 444 (154 residues), 242.2 bits, see alignment E=1.8e-76

Best Hits

Swiss-Prot: 89% identical to HGD_CUPNJ: Homogentisate 1,2-dioxygenase (hmgA) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K00451, homogentisate 1,2-dioxygenase [EC: 1.13.11.5] (inferred from 89% identity to reu:Reut_B3923)

MetaCyc: 52% identical to Homogentisate 1,2-dioxygenase (Homo sapiens)
Homogentisate 1,2-dioxygenase. [EC: 1.13.11.5]

Predicted SEED Role

"Homogentisate 1,2-dioxygenase (EC 1.13.11.5)" in subsystem Homogentisate pathway of aromatic compound degradation (EC 1.13.11.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YDN3 at UniProt or InterPro

Protein Sequence (449 amino acids)

>RR42_RS31275 Homogentisate 1,2-dioxygenase (EC 1.13.11.5) (Cupriavidus basilensis FW507-4G11)
MTQTQLNVVNVTGQAPDHGTPGYQSGFANEFATEALPGALPVGQNSPQRAPYGLYAEQIS
GTAFTAPRAHNRRSWCYRIRAAAMHEPFTRVEQSRIVSHFDAVPPSPNQMRWSPPAMPKE
PTDFVDGIITMAGNGGPEAMSGCGIHLYLANRSMTDRFFYNADGEMLIVPQQGRLRLATE
MGLLDVEPQEIVVIPRGVRFRVELPDGEARGYICENYGALFRLPDLGVIGSNGLANPRDF
LTPHAWYEDREGDFELVAKFQGNLWRAAIGHSPLDVVAWHGNYAPYKYDLRRFNTIGSIS
FDHPDPSIFLVLQSPSDTPGVDSIDFVIFGPRWLAMQNTFRPPWFHRNIASEFMGLIEGV
YDAKADGFSPGGASLHNCMSGHGPDAETFAKATAADTSQPHRIGDTMAFMFETPAVIRPT
PYAAESAQLQDDYYRCWQGLKKHFNPNER