Protein Info for RR42_RS31200 in Cupriavidus basilensis FW507-4G11

Annotation: 3-oxoacyl-ACP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00109: ketoacyl-synt" amino acids 71 to 229 (159 residues), 72.9 bits, see alignment E=4.9e-24 PF00108: Thiolase_N" amino acids 140 to 189 (50 residues), 26.5 bits, see alignment 6.1e-10 PF02801: Ketoacyl-synt_C" amino acids 237 to 335 (99 residues), 100.1 bits, see alignment E=1.3e-32

Best Hits

KEGG orthology group: K00647, 3-oxoacyl-[acyl-carrier-protein] synthase I [EC: 2.3.1.41] (inferred from 68% identity to rme:Rmet_4389)

Predicted SEED Role

"3-oxoacyl-[ACP] synthase (EC 2.3.1.41) FabV like" (EC 2.3.1.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.41

Use Curated BLAST to search for 2.3.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YMF8 at UniProt or InterPro

Protein Sequence (393 amino acids)

>RR42_RS31200 3-oxoacyl-ACP synthase (Cupriavidus basilensis FW507-4G11)
MNVFINALGVTCALGDGADAVRAALWRGDAPQGGEVTELYSPGRPLQLGTVNTALSLPDD
TPRVHRTRNNALLYHAALQFMPQAQAAIARVGPARVAVVLGTSTSGIAEGGVAVRARAAT
GAWPEGFHYGQQELGSPAQFLAGVLGVTGVAYTLSTACSSSAKALAAAARLLRSGMADVV
IAGGADTLCSFTVAGFSALDSVSASRCNPLSANRCGINLGEGAGLFLLSAEPGPVRLAGC
GETSDAHHMSAPDPSGAGARAAMLQALERAGLAPADIDYLNLHGTATPQNDAMEALACAA
VFGADLPLSSTKPMTGHALGAAGAIEAALMWLTLVDNPHGRLPPHWWDGVPDPALPALRV
VAPGETLGRAPRYVMSNSFAFGGSNSAVILGAG