Protein Info for RR42_RS31155 in Cupriavidus basilensis FW507-4G11

Annotation: TonB-dependent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 828 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details PF07715: Plug" amino acids 172 to 275 (104 residues), 65.7 bits, see alignment E=5e-22 TIGR01783: TonB-dependent siderophore receptor" amino acids 174 to 826 (653 residues), 321.6 bits, see alignment E=6e-100 PF00593: TonB_dep_Rec" amino acids 359 to 800 (442 residues), 158.7 bits, see alignment E=4.5e-50

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 56% identity to mms:mma_3483)

Predicted SEED Role

"TonB-dependent siderophore receptor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YDL2 at UniProt or InterPro

Protein Sequence (828 amino acids)

>RR42_RS31155 TonB-dependent receptor (Cupriavidus basilensis FW507-4G11)
MPSSQPRDRYRHTPLVLALRAALLGCALGATVMMPAIAQAQAAPAGSKAYDIGAGSLDQV
LGRFGREAGVLVAIDPELTQGLRSEGLRGIYTVAEALAKLLSGQQLEAVSGPSGGYRLRK
RSAPSAAPAPDGAPMLAEVKVTASGPGDGITQGSGSYTSDASSTATRLGISLRETPQSVS
VMTRQQMDDQGLNALTDVITRTPGLTINQSGNLGSDSSSAYARGFAVENYQLDGVLQLNS
GFGDLFQTSDMAIYDRVEVVRGATGLMNGIGSPGATINLVRKRPTRDFQASASVEGGSWD
YRRFGVDVSSPFNEAGTLRGRVVAAYQENNSSVERLHERREIVYGVVEADLTPSTLAALG
FSLQSFDLQGHARSGLPLYFADGTRTDWARSKSSAADWAYSYRRNQSLFASLEHRFDNAW
RVKGTVSQDTYGYDEVFGYAGNGFPDRSTGAGLALWGGRWGGKPEQTSVDLYATGPFSLL
GREHEMVFGATFARTSYDSATYQLWRPDGWDGSIANIYTWDGRTPGIAPNPPVGRYNYAE
QTTAAYATARLRQTDALSVLLGARITNWSTDTRDSVNSTGATTVDNRSANGKVTPYVGVV
YDLSRHWSAYASYTSIFKPQNNRTLSGSFIDPVVGNGYEVGGKGAFFNNQLNVSGALFWV
KQDNLAVAIPGAFAPDGSQAYYGASGAKTRGFELEAAGQLARDWQATVSFTRSLSQDKDG
ITLNTNIPQNTFKLFTTYRIAAVGNGLTVGGGLRWQSQIYSDNTGPLSVRSTQGSYSVAD
LMARYPITRKISATLNVYNLFDKRYHTTSNTAFYGTPRSFRLGLNVSY