Protein Info for RR42_RS30990 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 66 (23 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details PF03994: DUF350" amino acids 14 to 67 (54 residues), 47 bits, see alignment E=1.1e-16 amino acids 79 to 131 (53 residues), 41.2 bits, see alignment E=7e-15

Best Hits

Swiss-Prot: 36% identical to YJFL_ECO57: UPF0719 inner membrane protein YjfL (yjfL) from Escherichia coli O157:H7

KEGG orthology group: K08989, putative membrane protein (inferred from 77% identity to reh:H16_A0040)

Predicted SEED Role

"protein of unknown function DUF350"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YSV0 at UniProt or InterPro

Protein Sequence (132 amino acids)

>RR42_RS30990 membrane protein (Cupriavidus basilensis FW507-4G11)
MTMPLQPVYAYLIYILSSFAMLGLFLLVYTRITPHREFELIRRGNVAAALSLGGAVLGFS
LTLSASIQHNAAFSMFVLWGFGAFVVQVLAYVLVARALRGVSEEITADNRGMGALMGVVS
LAAGIVNAACLA