Protein Info for RR42_RS30955 in Cupriavidus basilensis FW507-4G11

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 175 to 194 (20 residues), see Phobius details PF21085: CusS" amino acids 8 to 159 (152 residues), 29.6 bits, see alignment E=1.4e-10 TIGR01386: heavy metal sensor kinase" amino acids 8 to 466 (459 residues), 479.2 bits, see alignment E=7.5e-148 PF00672: HAMP" amino acids 192 to 245 (54 residues), 35.1 bits, see alignment 2.6e-12 PF00512: HisKA" amino acids 250 to 314 (65 residues), 47.5 bits, see alignment E=3.1e-16 PF02518: HATPase_c" amino acids 359 to 467 (109 residues), 88.7 bits, see alignment E=7.1e-29

Best Hits

KEGG orthology group: K07644, two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC: 2.7.13.3] (inferred from 74% identity to reh:H16_B1646)

Predicted SEED Role

"Signal transduction histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YMA6 at UniProt or InterPro

Protein Sequence (480 amino acids)

>RR42_RS30955 histidine kinase (Cupriavidus basilensis FW507-4G11)
MRAVLRLPASLTARLALAYGAATVAILVAVGTYLASALAAQLQDRDESELVSEVLLVRHL
LREVGSEAEIRADTHRFADLALGHEGLILLVRGSGGEPLVTLNPRHEPVPALPVLPAATP
PDKSRLHTWYPRNGVASRGISALGQLGDSERAVEIVVLRDAGYRVALMKAYQTQMLWATL
CGAAVAAGLGYLLARRGLRPLRRMAQDASAVTMSRLATRLDAGQAPTELRALVAALNDML
ARLEDGFHRLSEFSADLAHDFRTPISNLIGQTQVTLGHSRPVQEYENLLESNLEEYERLA
RMIENMLFLARADHAQVAMTVRELDARAELDKVAEYYEAVAADRDIKVQLAGQGAVRADQ
TLLRRAVTNLVDNALRHAPAGSAVDIRVVADTAATRIQVSNGGTGIAAEALPHVFGRFYR
GDPARSNSAGSTGLGLAIVDTIMRLHGGSVSMRSRPGETVAELKFPTQHAGSATDPAGRR