Protein Info for RR42_RS30795 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 signal peptide" amino acids 1 to 46 (46 residues), see Phobius details transmembrane" amino acids 61 to 81 (21 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 120 to 143 (24 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details amino acids 287 to 318 (32 residues), see Phobius details amino acids 330 to 350 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 60 to 344 (285 residues), 131.3 bits, see alignment E=1.8e-42

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 86% identity to reu:Reut_B3991)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YM80 at UniProt or InterPro

Protein Sequence (363 amino acids)

>RR42_RS30795 ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MRLEARTSVSRMAMLAAPIVAILATLLICALLVRWAGAPVGRAYALLLEGGFGSRFAWSE
TLTRATPLILTGLSVAVAFRARLFNIGAEGQLYLGALAAVAVGGQVDGAVAPWAQQLPMG
LLFVLMVVAGMLAGAMLLLGAAWLKTRLGVDEVVTTLLANFIVLLFVSMMLDGPMKDATA
MGWPQSVALVPELELARLVERSRVHSGLLLACALAVMLWAVNRFTVFGLQMRAVGANARA
AAFAGMPVRSVTMWAALLSGGLAGLAGVVEVAGRTSYLTLDISPGYGYAGVVIAMLAGLH
PLGVVAASVFVAGVLVGADGMSRAAGVPNSIADVIVAVALLAMLVATMLTRYRIRLDAPG
KVA