Protein Info for RR42_RS30790 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 133 to 145 (13 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details amino acids 201 to 231 (31 residues), see Phobius details amino acids 233 to 247 (15 residues), see Phobius details amino acids 250 to 267 (18 residues), see Phobius details amino acids 284 to 307 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 16 to 298 (283 residues), 109.6 bits, see alignment E=7.9e-36

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 90% identity to reu:Reut_B3992)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YNP0 at UniProt or InterPro

Protein Sequence (321 amino acids)

>RR42_RS30790 ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MMELLDIVASAPFWIAVLRVATPLIFGTLGVLLCERAGVLNLGIEGIMVAGAFSGWLAVY
HGAPLWGGVAVAAGVGLAFGLLHGWLTVSLALSQHVAGLGVTMLATSLSYYAYRLGFASV
STPPTITPFAPMHWIGGVPLIGGMFSPVFGEETALTLLALGLVPVVAWLLYRTPLGLAVR
MVGENPAAAEGQGIRVGATRIGAIMAGSALMAVGGAFLTLSAFNAFFFNMINGRGWICVA
LVVFASWRPGRALAGALLFAAFDALQLRLQQSGASLPGLPPLPYQLYLMLPYVLSILALV
LVARRAAYPQALMKPYRRGER