Protein Info for RR42_RS30610 in Cupriavidus basilensis FW507-4G11

Annotation: cystathionine beta-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR01324: cystathionine beta-lyase" amino acids 7 to 387 (381 residues), 410.2 bits, see alignment E=3.3e-127 PF01053: Cys_Met_Meta_PP" amino acids 7 to 386 (380 residues), 330.3 bits, see alignment E=5.9e-103

Best Hits

Swiss-Prot: 46% identical to METC_RHIL3: Putative cystathionine beta-lyase (metC) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: K01760, cystathionine beta-lyase [EC: 4.4.1.8] (inferred from 69% identity to bbr:BB1542)

Predicted SEED Role

"Cystathionine beta-lyase (EC 4.4.1.8)" in subsystem Methionine Biosynthesis (EC 4.4.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.4.1.8

Use Curated BLAST to search for 4.4.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YKQ8 at UniProt or InterPro

Protein Sequence (405 amino acids)

>RR42_RS30610 cystathionine beta-lyase (Cupriavidus basilensis FW507-4G11)
MKPSILTHLAHAGRASAVDGGQPVNPPVVRASTVLFDSVAQMREMRSRRGSERLFTYGAR
GNPTAFALEDMVTELEAGYRTRLFPSGLAAAAMTLLAYLRPGQHVLLPDCVYEPVRKLAE
GFLAQHGIAASFYAADGHDLQARLRRETRLVYVEAPGSLAYEMCDLPAIADIAHRHGALV
AADNTWGSGLLYQPLALGADISLMAATKYLSGHSDVMMGTVCTLEAAWPALAAVADAFGI
SVSPDDAYLVQRGMRSLGARLSQHERSALAVAHWLRTRPEVAEVFCPALPGDPGHALWQR
DCHGTNGLLSFALRAVAPDAAERFIDSLALFGIGASWGGFESLAVIADMRGARSVTDWSG
RGQVIRLHIGLEDVDDLLADLARGFEVIGGGRVAGRALEARLDTA