Protein Info for RR42_RS30505 in Cupriavidus basilensis FW507-4G11

Annotation: salicylate hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01494: FAD_binding_3
  • amino acids 10 to 328 (319 residues), 94.7 bits, E=2.4e-30
• PF01134: GIDA
  • amino acids 10 to 164 (155 residues), 32.4 bits, E=1.9e-11
• PF00890: FAD_binding_2
  • amino acids 11 to 45 (35 residues), 21.8 bits, 3.5e-08
• PF12831: FAD_oxidored
  • amino acids 11 to 144 (134 residues), 28.2 bits, E=4.2e-10
• PF13450: NAD_binding_8
  • amino acids 13 to 44 (32 residues), 29.5 bits, see alignment (E = 2.6e-10)

Best Hits

Swiss-Prot: 67% identical to 3HBH_KLEOX: 3-hydroxybenzoate 6-hydroxylase (mhbM) from Klebsiella oxytoca

KEGG orthology group: K00480, salicylate hydroxylase [EC: 1.14.13.1] (inferred from 82% identity to reh:H16_B0876)

Predicted SEED Role

"Putative n-hydroxybenzoate hydroxylase" in subsystem Gentisare degradation or Salicylate and gentisate catabolism

MetaCyc Pathways

• superpathway of salicylate degradation (7/7 steps found)
• methylsalicylate degradation (2/2 steps found)
• salicylate degradation I (1/1 steps found)
• chlorosalicylate degradation (3/7 steps found)
• naphthalene degradation to acetyl-CoA (6/12 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (21/42 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Bile acid biosynthesis
• Fluorene degradation
• Naphthalene and anthracene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.1

Use Curated BLAST to search for 1.14.13.1

Sequence Analysis Tools

See A0A0C4YD96 at UniProt or InterPro

Protein Sequence (402 amino acids)

>RR42_RS30505 salicylate hydroxylase (Cupriavidus basilensis FW507-4G11)
MNNTRSTDRKVIVVGGGIGGLAAALALARQGIRVELLEQAAQIGEIGAGIQLGANAFAAL
DALGVGDAARKRSVFTDYLVMMDALDATEVAKVDVGERYRQRFGNPYAVIHRADIHLSIL
EAVRDHPLIQFRTATTVCALEQDERGVSVIDQHGERHQGDAVIGCDGVKSAVRQALLGDE
PRVTGHVVYRAVVDVADMPADLQINAPVVWAGPNCHLVHYPLRGGEQYNLVVTFHSREQE
VWGVRDGSKEEVLSYFEGIHARPHQMLDRPTSWRRWATADRDPVAQWSFGRATLLGDAAH
PMTQYLAQGACQALEDAVTLGAAVAETEGDFVAAFALYERARIPRTARVLYSAREMGRLY
HAKGVERLVRNSLWVGRTQDQFYDALQWLHGWRAEDCLGGAR