Protein Info for RR42_RS29550 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 95 to 112 (18 residues), see Phobius details amino acids 124 to 147 (24 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 193 to 222 (30 residues), see Phobius details amino acids 244 to 267 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 103 to 275 (173 residues), 93.9 bits, see alignment E=5.3e-31

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 84% identity to bam:Bamb_0024)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YLH6 at UniProt or InterPro

Protein Sequence (283 amino acids)

>RR42_RS29550 ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MEVTMEAMTAISDEIFEREAKRSINKRYWLIVSLRIGLLVAGLGGWELAGRLHWIDPFFF
SMPSLIAEQIYDWFVNGTSQGPLLAQVAVTLEETGLGFLIGSVAGVICGIVLGRNKLLAD
VFSIYIQIANSIPRVVLGSIFVIALGLGMASKVALAVVMVFFVVFGNAFQGVREADRYLI
ANAQILGASKRQLTFAVVVPSALSWILASLHVSFGFALVGAVVGEFLGSKQGIGLLIATA
QGAFNASGVFAAMIVLAVVALAADFLLTTMERRLLKWRPGNLA