Protein Info for RR42_RS29370 in Cupriavidus basilensis FW507-4G11

Annotation: chromate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 18 to 42 (25 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 88 to 113 (26 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details amino acids 274 to 297 (24 residues), see Phobius details amino acids 305 to 329 (25 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details amino acids 373 to 405 (33 residues), see Phobius details PF02417: Chromate_transp" amino acids 19 to 185 (167 residues), 139.7 bits, see alignment E=4.8e-45 amino acids 236 to 402 (167 residues), 130.8 bits, see alignment E=2.7e-42 TIGR00937: chromate efflux transporter" amino acids 25 to 401 (377 residues), 357 bits, see alignment E=8.8e-111

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 76% identity to eum:ECUMN_4818)

Predicted SEED Role

"Chromate transport protein ChrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YRW7 at UniProt or InterPro

Protein Sequence (408 amino acids)

>RR42_RS29370 chromate transporter (Cupriavidus basilensis FW507-4G11)
MLATENEVKRDRDAIANAWAVLLAFLRLGLTSFGGPIAHLGYFREEFVTRRRWLSERSYA
DLVALCQFLPGPASSQVGMAIGLSRAGFMGAVAAWVGFTLPSAVALVLFALSISTWGDVI
PAGALHGLKVVAVAVVAQAVWGMARSLCTDTTRITIAAFSACIAQLWPNAWGQVGVIAAS
AVVGLAMFKPARDVTHDPLPISISRRVGGLLLGAFFILLAGLPLAVQAWPNQTLAVAGAF
YRAGSLVFGGGHVVLPLLQAAVVPSGWVTNDTFLAGYGAAQAVPGPLFTFAAFLGASMTV
APSGWIGALVCLVAIFVPSFLLVAGTLPFWEQLRRNVRTQAALAGVNAGVVGLLLAALYH
PVWTSAVHGPADFGLAVIAFVALMFWKLPPWLVVICSGAAGWLLSVAL