Protein Info for RR42_RS29350 in Cupriavidus basilensis FW507-4G11

Annotation: glycerol uptake facilitator or water-selective channels

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 38 to 62 (25 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 188 to 211 (24 residues), see Phobius details PF00230: MIP" amino acids 6 to 148 (143 residues), 63.5 bits, see alignment E=1.3e-21

Best Hits

KEGG orthology group: None (inferred from 80% identity to rpf:Rpic12D_5347)

MetaCyc: 54% identical to aquaglyceroporin (Sinorhizobium meliloti)
TRANS-RXN0-551

Predicted SEED Role

"Aquaporin Z"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YCN5 at UniProt or InterPro

Protein Sequence (241 amino acids)

>RR42_RS29350 glycerol uptake facilitator or water-selective channels (Cupriavidus basilensis FW507-4G11)
MIGLPRQIAGEVIGTALLLAVVIGSGIMAERLAGGNVAVALLANTLATVGGLYVLIEVFG
PISGAHFNPAVSMVMAVKGELPRYALAPYIVAQLAGAVLGAWLAHAMFDVSILQLSAKMR
SGPGQWIAEAVATAGLILVILRAPDGRAPAMVASYIGAAYWFTASTSFANPAAAFGRMFS
NSFAGIAPASVPGFVLAELLGACIGLLLHTALLPRVQEQGHPNVIEASGQQEDSPATGGH
I