Protein Info for RR42_RS29245 in Cupriavidus basilensis FW507-4G11

Annotation: nitrile hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 TIGR03888: nitrile hydratase, beta subunit" amino acids 1 to 218 (218 residues), 259.8 bits, see alignment E=1.3e-81 PF21006: NHase_beta_N" amino acids 1 to 104 (104 residues), 127.1 bits, see alignment E=3.7e-41 PF02211: NHase_beta_C" amino acids 121 to 217 (97 residues), 125.9 bits, see alignment E=7.2e-41

Best Hits

KEGG orthology group: K01721, nitrile hydratase [EC: 4.2.1.84] (inferred from 67% identity to bpy:Bphyt_7182)

Predicted SEED Role

"Cobalt-containing nitrile hydratase subunit beta (EC 4.2.1.84)" (EC 4.2.1.84)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.84

Use Curated BLAST to search for 4.2.1.84

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YLA8 at UniProt or InterPro

Protein Sequence (223 amino acids)

>RR42_RS29245 nitrile hydratase (Cupriavidus basilensis FW507-4G11)
MNGGQDLGGMQGFGPVRPEADEPVFHAGWERRMLALTLAMGALGKWNIDTMRAARESLPP
AQYLGSSYYQIWFEGLKAMLLRTGMANAEEIASGASTTPPLPLARILSADQVAPALARGT
PSARPAPGAARFQVGDRVRTRQMHPAGHTRLPRYCRGRQGEIAAVHGAHVFPDASAAGAG
DQPQWLYTVRFAATELWGPDTTAASVCADCWESYLDPAEVAHG