Protein Info for RR42_RS29090 in Cupriavidus basilensis FW507-4G11

Annotation: galactarate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 TIGR03248: galactarate dehydratase" amino acids 6 to 512 (507 residues), 956.3 bits, see alignment E=1.6e-292 PF08666: SAF" amino acids 14 to 80 (67 residues), 29.2 bits, see alignment E=1.7e-10 PF04295: GD_AH_second" amino acids 114 to 258 (145 residues), 125.6 bits, see alignment E=2.3e-40 PF20629: GD_AH_C" amino acids 268 to 509 (242 residues), 309.7 bits, see alignment E=1.8e-96

Best Hits

Swiss-Prot: 66% identical to GARD_BACSU: Probable galactarate dehydratase (L-threo-forming) (garD) from Bacillus subtilis (strain 168)

KEGG orthology group: K01708, galactarate dehydratase [EC: 4.2.1.42] (inferred from 89% identity to rme:Rmet_4734)

Predicted SEED Role

"D-galactarate dehydratase (EC 4.2.1.42)" in subsystem D-Galacturonate and D-Glucuronate Utilization or D-galactarate, D-glucarate and D-glycerate catabolism (EC 4.2.1.42)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.42

Use Curated BLAST to search for 4.2.1.42

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YL77 at UniProt or InterPro

Protein Sequence (512 amino acids)

>RR42_RS29090 galactarate dehydrogenase (Cupriavidus basilensis FW507-4G11)
MQGTALYIRIHALDNVAIVANDGGLPEGTVFPCGLTLRERVPQGHKVALVDLAAGDAVVR
YNVVIGYALRDLPKGSWVNERVIEMPVAPGLDNLPVGTRVAEPLPPLEGYSFEGFRNPDG
SVGTRNILAITTTVQCVSGVVEHAVRRIRAELLPQYPNVDDVVGLEHTYGCGVAIDAPDA
IVPIRTLRNIALNPNFGGTAMMVSLGCEKLQPERLLPAGSLPGGLDVGVVCLQDDEHVGF
ESMIDSIMAMAHTHLARLDQRRRETCPASELVVGVQCGGSDAFSGVTANPAVGFATDLLV
RAGATVMFSEVTEVRDGIDQLTARAATPEVAQAMIREMDWYDRYLEKGRVDRSANTTPGN
KKGGLSNIVEKAMGSIVKSGSTAITGVLSPGEKLKQKGLIYAATPASDFICGTLQLAAGM
NLHVFTTGRGTPYGLAEVPVIKVATRSDLARRWHDLMDVNAGRIATGEATIEDVGWELFR
LMLDVASGRKKTWAEHHKLHNSLVLFNPAPVT