Protein Info for RR42_RS28945 in Cupriavidus basilensis FW507-4G11

Annotation: mechanosensitive ion channel protein MscS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 58 to 83 (26 residues), see Phobius details amino acids 89 to 119 (31 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 107 to 172 (66 residues), 70.5 bits, see alignment E=1.1e-23

Best Hits

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 83% identity to reu:Reut_B4037)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YRN4 at UniProt or InterPro

Protein Sequence (276 amino acids)

>RR42_RS28945 mechanosensitive ion channel protein MscS (Cupriavidus basilensis FW507-4G11)
MDATTLQKYQDVVVTYATEVGFKVLAALVFWVVGRWLIHVVVRMVQGSLTKQKVDPTLLR
YVGSIVTVTLNIVLIIGILGYFGIQTTSFAALIAAAGIAIGMAWSGLMSNFAAGAFLVVL
RPFKVGDFVTVGGITGTVREIGLFATTLDTPDNVLTVVGNNKIFADTIQNFSANPYRRVE
LKAQLAGSTDVAAAASLLKERLAALPNVLAEPPPDVEILEFTLVGPVLAVRPYCHTDHYW
QVYFDSNRVIRESFGEAGFAAPMPAQLVVLQNGAAA