Protein Info for RR42_RS28835 in Cupriavidus basilensis FW507-4G11

Updated annotation (from data): gluconate:H+ symporter (gntT)
Rationale: 67% identical to the gluconate permease (gntT, ACIAD0544) of A. baylayi ADP1 (PMCid:PMC4254613). KEGG_correct
Original annotation: permease DsdX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 51 (20 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 104 to 133 (30 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details amino acids 338 to 361 (24 residues), see Phobius details amino acids 368 to 387 (20 residues), see Phobius details amino acids 393 to 416 (24 residues), see Phobius details amino acids 428 to 452 (25 residues), see Phobius details PF02447: GntP_permease" amino acids 9 to 450 (442 residues), 550.8 bits, see alignment E=2.2e-169 TIGR00791: transporter, gluconate:H+ symporter (GntP) family" amino acids 10 to 453 (444 residues), 503 bits, see alignment E=4.1e-155 PF03600: CitMHS" amino acids 29 to 398 (370 residues), 61 bits, see alignment E=1.2e-20

Best Hits

Swiss-Prot: 51% identical to GNTP_ZYMMO: Gluconate permease (gntP) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K03299, gluconate:H+ symporter, GntP family (inferred from 94% identity to reu:Reut_B4018)

Predicted SEED Role

"Gluconate transporter family protein" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YJP4 at UniProt or InterPro

Protein Sequence (453 amino acids)

>RR42_RS28835 gluconate:H+ symporter (gntT) (Cupriavidus basilensis FW507-4G11)
MGAVTGTTLLLYALIAVIALVVLIAKFKLNPFITLVVVSVLLGFAVGMPMGDIVKSFEAG
VGGTLGHIALVVGLGTMLGKMMAESGGAERIARTLIDAFGEKNVHWAMVTIAFIVGLPVF
FEVGFVLLVPIAFNVAKRTGTSMVLVGIPMVAGLSVVHGLIPPHPAALLAVTAYKADIGK
TILYALIVGIPTAAIAGPLFAKLMTRYVTLPDVNPLAAQFTEEDEGVKASHELPGFGITL
FTILLPVILMLIGSWADLITTPKTFANDFLKLIGNSVIALLIAALVSFYTFGKRRGFTRE
NILRFTNECVAPTAIITLVVGAGGGFGRVLRDSGISNAIVDVATGAHVSVLLLGWLVAVL
IRIATGSATVAMTTAAGIVAPIAASVPGTRPELLVLTTGAGSLILSHVNDGGFWLVKEYF
NMTVAQTFKTWSVCETLISVIALLLTLALATVV