Protein Info for RR42_RS28200 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 72 to 95 (24 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details PF11158: DUF2938" amino acids 12 to 160 (149 residues), 216.9 bits, see alignment E=4.6e-69

Best Hits

KEGG orthology group: None (inferred from 72% identity to reh:H16_A0053)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YC31 at UniProt or InterPro

Protein Sequence (173 amino acids)

>RR42_RS28200 membrane protein (Cupriavidus basilensis FW507-4G11)
MPEAVDYLMFALLIGAGATAVMDIWAAARERLLGIRPLDYALVGRWLAHLVRGRVCHDPI
AASPSVQGERLLGWIAHYLIGIAFAATLLAFWGLGWARHPTLGPALVVGIGSVAAPFFVM
QPAMGAGIAASRTPRPGVARFHSVVTHGIFGLGLYGAGWLASWLDTLAWRSVW