Protein Info for RR42_RS28150 in Cupriavidus basilensis FW507-4G11

Annotation: EmrB/QacA subfamily drug resistance transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 signal peptide" amino acids 9 to 11 (3 residues), see Phobius details transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 132 to 156 (25 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 262 to 285 (24 residues), see Phobius details amino acids 296 to 316 (21 residues), see Phobius details amino acids 328 to 347 (20 residues), see Phobius details amino acids 353 to 372 (20 residues), see Phobius details amino acids 393 to 416 (24 residues), see Phobius details amino acids 425 to 445 (21 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 13 to 407 (395 residues), 234.8 bits, see alignment E=9.2e-74 PF00083: Sugar_tr" amino acids 14 to 110 (97 residues), 28.5 bits, see alignment E=1.1e-10 PF07690: MFS_1" amino acids 15 to 404 (390 residues), 171.9 bits, see alignment E=2.7e-54 PF05977: MFS_3" amino acids 20 to 194 (175 residues), 27.8 bits, see alignment E=1.3e-10

Best Hits

Swiss-Prot: 44% identical to HSRA_ECOLI: Probable transport protein HsrA (hsrA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 81% identity to reu:Reut_B4302)

Predicted SEED Role

"putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YC18 at UniProt or InterPro

Protein Sequence (464 amino acids)

>RR42_RS28150 EmrB/QacA subfamily drug resistance transporter (Cupriavidus basilensis FW507-4G11)
MTSQTSQKAMLWIVAAGFFMQTLDTTIVNTALPAMARSLNETPLDMKPVVVAYTLTMAMF
TPASGWLADRFGTRRVYFAAILIFVLGSLFCAGAQNLDQLVIARVIQGVGGSMLLPIGRL
AVLRSVRGEQYIAALAFVSVAGQVGPIFGPVLGGWIVQSVAWHWIFLINVPVGAIGLLAV
LRYLPDHTVGRAPPFDFVGCGLLSLCMVAFSLALDTPHEASHAAWSGSLFALSLLSALLY
IPHARRRQNPLFRLALLREPNFSVGLAGNLVCRIGSGAVPFLMPLLLQLQMGYSPLHSGL
MLLPAALAGVVAKRWIVPLVKRFGYDNFLLVNTVLVGGSIASFAAIAPGWPVGLAIAQLA
LFGATNSMQFAAMNSVTLKGLSVEDAGSGNSLFSMVQMLAIGLGVTIGGGLVSMFTAQMG
VAGTAYRLAFFTVGMITLLSALVFRRLDVETLDKSRSPASVASR