Protein Info for RR42_RS28015 in Cupriavidus basilensis FW507-4G11

Annotation: phosphonate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details amino acids 79 to 104 (26 residues), see Phobius details amino acids 124 to 147 (24 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details amino acids 210 to 228 (19 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details TIGR01097: phosphonate ABC transporter, permease protein PhnE" amino acids 17 to 262 (246 residues), 305.2 bits, see alignment E=1.8e-95 PF00528: BPD_transp_1" amino acids 91 to 261 (171 residues), 73.9 bits, see alignment E=7.1e-25

Best Hits

Swiss-Prot: 66% identical to PHNE_ECOBD: Phosphonate transport system permease protein PhnE (phnE) from Escherichia coli (strain B / BL21-DE3)

KEGG orthology group: K02042, phosphonate transport system permease protein (inferred from 87% identity to axy:AXYL_05087)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YKL0 at UniProt or InterPro

Protein Sequence (263 amino acids)

>RR42_RS28015 phosphonate ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MIPATPPRAVRAPRASLPVMFVWAVVLALLAMSWQGADMRPLDLWRDSGNMAKFAADFFP
PSFRDWRIYLDEMLVTVQIAIWGTFLSIVFAVPLGLACSANIVPAWVYQPMRRVMDACRA
INEMVFAMLFIVAVGLGPFAGVLALWVHTTGVLAKLFSEAVEAIDPRPVEGVRATGASAL
EEVVYGVIPQVLPLWISYALYRFESNVRSATVLGIVGAGGIGTVLWEIIRSFQYAETCAV
IIIIVGFVTVIDLLSARIRKALV