Protein Info for RR42_RS28005 in Cupriavidus basilensis FW507-4G11

Annotation: phosphonate/organophosphate ester transporter subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 TIGR02315: phosphonate ABC transporter, ATP-binding protein" amino acids 5 to 251 (247 residues), 279.6 bits, see alignment E=1e-87 PF00005: ABC_tran" amino acids 21 to 182 (162 residues), 107.3 bits, see alignment E=1e-34

Best Hits

Swiss-Prot: 82% identical to PHNC_CUPNJ: Phosphonates import ATP-binding protein PhnC (phnC) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K02041, phosphonate transport system ATP-binding protein (inferred from 82% identity to reu:Reut_B4177)

Predicted SEED Role

"Phosphonate ABC transporter ATP-binding protein (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YJ92 at UniProt or InterPro

Protein Sequence (279 amino acids)

>RR42_RS28005 phosphonate/organophosphate ester transporter subunit (Cupriavidus basilensis FW507-4G11)
MTHAIEVRGLSKSFQAGRKALDDVSLAVAPGEMVALLGASGSGKSTLLRHVAGFVAADAG
GAGEVRVNGRAIQQGGRLARDVRAARAEIGFVFQQFNLVGRLPVITNVLTGMLPRVPLWR
SLIRLFRVGEIDAGLEALAQVGIDDYAFRRASTLSGGQQQRAAIARTLVQNARVILADEP
IASLDPESARRVMELLAQINRARRVAVVVSLHQVDVAMRYCPRVVALRHGKVVYDGPSAA
LTPAMLRELYGTQAAELLPDGAGLEVAAPAMPHGGLAAA