Protein Info for RR42_RS27985 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 transmembrane" amino acids 21 to 47 (27 residues), see Phobius details amino acids 53 to 81 (29 residues), see Phobius details amino acids 122 to 145 (24 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details PF09335: SNARE_assoc" amino acids 48 to 172 (125 residues), 55.2 bits, see alignment E=5.1e-19

Best Hits

Swiss-Prot: 43% identical to DEDA_ECOLI: Protein DedA (dedA) from Escherichia coli (strain K12)

KEGG orthology group: K03975, membrane-associated protein (inferred from 63% identity to bpy:Bphyt_5807)

Predicted SEED Role

"DedA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YM31 at UniProt or InterPro

Protein Sequence (216 amino acids)

>RR42_RS27985 membrane protein (Cupriavidus basilensis FW507-4G11)
MEASQVLPLLLHFDQHLGPAIAQYGVLVYGILFAIVFCEIGLLPLFFLPGDPLLFLCGAF
CAAGALKLWILLPVLLIAAVAGSLLNYAIGKAIGERVFTGGYRWINRDALRRTHDFYQRH
GGLTLLLSPFVAVVRTFAPFVAGVSAMSATRFALAASAGATVWVVSLLAGGYLFGNVPLV
RDHMSAIVLLGLALGLGSLVVASAWRAVKGRQGARG