Protein Info for RR42_RS27975 in Cupriavidus basilensis FW507-4G11

Annotation: osmotically inducible protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 PF12697: Abhydrolase_6" amino acids 32 to 230 (199 residues), 44.7 bits, see alignment E=7.9e-15 PF00561: Abhydrolase_1" amino acids 33 to 142 (110 residues), 30.9 bits, see alignment E=6.9e-11 PF12146: Hydrolase_4" amino acids 47 to 133 (87 residues), 50.2 bits, see alignment E=6.7e-17 PF00326: Peptidase_S9" amino acids 50 to 252 (203 residues), 27.1 bits, see alignment E=8.5e-10 PF02566: OsmC" amino acids 301 to 402 (102 residues), 66.3 bits, see alignment E=9e-22

Best Hits

KEGG orthology group: K06889, (no description) K07397, putative redox protein (inferred from 65% identity to oca:OCAR_4313)

Predicted SEED Role

"Bll2902 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YBX6 at UniProt or InterPro

Protein Sequence (410 amino acids)

>RR42_RS27975 osmotically inducible protein C (Cupriavidus basilensis FW507-4G11)
MEAQRLQFPGSDGQQLSARLDLPVGPVRTFALFAHCFTCGKDVLAATRIAQALTAHGIAV
LRFDFTGLGGSGGDFANTNFSSNVADLLAAADYLRQHHRAPALLIGHSLGGAAVLSAAHG
IPEAKAVVTIAAPSDPSHVVGLFGDQAARIEADGQAEVRLAGRAFKIKRQFIEDVAEQKL
LDSVAKLRKALLVMHAPQDDTVGIDNATQIFIAAKHPKSFVSLDRADHLLTRKADAVYVA
NTIAAWSQRYLDIDALDVPAAVAEEGLVRVEESHVGKYQERITAGPHHLLADEPVSFGGL
NGGPAPYDLLLAGLGACTAMTMRMYADRKGWPLEHVAVTLRHEKIHATDSAECSTTEGKI
DWIEREITMRGPLDEAQRAALMEIADKCPVHRTLHSEVVVRTHLAATAAR