Protein Info for RR42_RS27955 in Cupriavidus basilensis FW507-4G11

Annotation: Short chain fatty acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 95 to 122 (28 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details amino acids 305 to 326 (22 residues), see Phobius details amino acids 354 to 371 (18 residues), see Phobius details amino acids 408 to 424 (17 residues), see Phobius details amino acids 436 to 457 (22 residues), see Phobius details PF02667: SCFA_trans" amino acids 2 to 447 (446 residues), 297.5 bits, see alignment E=9.9e-93

Best Hits

KEGG orthology group: K02106, short-chain fatty acids transporter (inferred from 87% identity to reu:Reut_B5759)

Predicted SEED Role

"Short chain fatty acids transporter" in subsystem Polyhydroxybutyrate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YR77 at UniProt or InterPro

Protein Sequence (463 amino acids)

>RR42_RS27955 Short chain fatty acid transporter (Cupriavidus basilensis FW507-4G11)
MERLAVKVTDWSERWFPDSYIFAAIAVIVVALGAMAIGAPAHGVARAFGDGFWSLIPFTM
QMAVVAISGYVVAASPPASLLIERLAALPRTARGAIAFVALVSLLTSLLNWAISLIFSGL
LVRAIARRTGLRVDYRAASAAAYLGMGATWALGLSSSAAQLQANPASLPKSLLDITGVIP
FSQTIFLWQSMAMTAVLIVASLLVAYFSAPAGERARTAQDMGVDIDDAGDGIGRPTRPGE
WLEYSPLLTLLIVALGAGWLVHEFTTKDPILAISNLNTYNFLFLMLGMLLNWRPKRFLRA
VARSVPSTAGVLIQFPLYGGIAFILTKAAGMDGTTLSHHLASAFVSVATKDSFSAVMGVY
SAVLGFFVPSGGGKWVIEAPYVMQAANELQVHLGWAVQVYNAAEALPNLINPFWMLPLLG
VLGIRAKDVVGFTFTQLLVHAPLVLFMLWAFAATLPYSPPVMP