Protein Info for RR42_RS27910 in Cupriavidus basilensis FW507-4G11

Annotation: Crp/Fnr family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF00027: cNMP_binding" amino acids 38 to 124 (87 residues), 47.1 bits, see alignment E=1.9e-16 PF13545: HTH_Crp_2" amino acids 158 to 227 (70 residues), 45.1 bits, see alignment E=7.8e-16

Best Hits

KEGG orthology group: None (inferred from 81% identity to cti:RALTA_B1050)

Predicted SEED Role

"transcriptional regulator, Crp/Fnr family" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YKI5 at UniProt or InterPro

Protein Sequence (233 amino acids)

>RR42_RS27910 Crp/Fnr family transcriptional regulator (Cupriavidus basilensis FW507-4G11)
MTTPPPGAGHAALLSRHEWFAALAPSHQALAARQVVVQDFAAGAFVAHRGEPSRYWIGVE
TGLIKLAVYTPDGRGCTFSGVPAGGWCGEGSVIKREARRYDVIAIRDSRLALVPDTVFHT
LLNESLPFASFVVRQLNERMGQFIATVQNERLLSVDARVAQAVAQLFHPALYPRTSSVLE
LSQEEIGLLTGLSRQRVNQALRRLAAEGMVDLSYQSIRVTDLERLRHFGLSEL