Protein Info for RR42_RS27770 in Cupriavidus basilensis FW507-4G11

Annotation: CDP-diacylglycerol--serine O-phosphatidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 49% identical to PSS_SCHPO: CDP-diacylglycerol--serine O-phosphatidyltransferase (pps1) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K00998, phosphatidylserine synthase [EC: 2.7.8.8] (inferred from 83% identity to reu:Reut_B4325)

Predicted SEED Role

"CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.8)

MetaCyc Pathways

superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
phosphatidylserine and phosphatidylethanolamine biosynthesis I (2/2 steps found)
cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)
superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.8

Use Curated BLAST to search for 2.7.8.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YR36 at UniProt or InterPro

Protein Sequence (210 amino acids)

>RR42_RS27770 CDP-diacylglycerol--serine O-phosphatidyltransferase (Cupriavidus basilensis FW507-4G11)
MASPPERPKHFSMIRELHLADLFTLGNAACGMASVFFAMFYIASGSSAHFMAAAALAPAA
FIFDVLDGRIARWRHQHSALGRELDSLADIISFGVGPATLAFAAGMRGGWDMAALIYFVC
CGVSRLARFNVTAETLSEGSDKVAYFEGTPIPTSVLLTAVLAFCAWQGRVGDALYGGVWS
IGPADLHPLALLFVLSGSLMISKTLRIPKM