Protein Info for RR42_RS27590 in Cupriavidus basilensis FW507-4G11

Annotation: amino acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 42 to 67 (26 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 154 to 178 (25 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details PF01810: LysE" amino acids 15 to 207 (193 residues), 116.8 bits, see alignment E=4.4e-38

Best Hits

KEGG orthology group: None (inferred from 56% identity to bav:BAV0227)

Predicted SEED Role

"putative amino acid efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YBP7 at UniProt or InterPro

Protein Sequence (214 amino acids)

>RR42_RS27590 amino acid transporter (Cupriavidus basilensis FW507-4G11)
MTLATLLLFIFASAVTIATPGPTVLLALNNGSRHGVRKACWGMAGALAADVILVVTVAAG
LGAVIAASEHAFEAIKWFGAAYLAYVGWKMLRAGKMPLTAQTVRQTEPDTAAARGRVLFS
RSFLVALTNPKALLFISAFLPQFIDTSAALLPQYAILTLAQCLLNLAVMLVYAALGARIV
HAFRGDGMRWLNRLSGGTLIALAGGLAFYRRAQA