Protein Info for RR42_RS27575 in Cupriavidus basilensis FW507-4G11

Annotation: arabinose transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 40 to 61 (22 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 129 to 153 (25 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details amino acids 238 to 256 (19 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 290 to 310 (21 residues), see Phobius details amino acids 331 to 351 (21 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details PF07690: MFS_1" amino acids 8 to 317 (310 residues), 138.9 bits, see alignment E=2e-44 PF00083: Sugar_tr" amino acids 37 to 177 (141 residues), 33.4 bits, see alignment E=2.5e-12

Best Hits

Swiss-Prot: 46% identical to YDHP_ECOLI: Inner membrane transport protein YdhP (ydhP) from Escherichia coli (strain K12)

KEGG orthology group: K08156, MFS transporter, DHA1 family, arabinose polymer transporter (inferred from 76% identity to hse:Hsero_3211)

Predicted SEED Role

"Arabinose efflux permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YLU7 at UniProt or InterPro

Protein Sequence (385 amino acids)

>RR42_RS27575 arabinose transporter permease (Cupriavidus basilensis FW507-4G11)
MRLPLLALAAAAFGIGTTEFVIMGLLPDVAADLGVSAPAAGMLVSGYAIGVAAGAPILAI
LTNKWPRKTALVGLMGLFILGNALCALAPNYALLMAARVVTAFCHAAFFGIGAVVAAELV
PRGRRAQAVALMFTGLTVANVLGVPFGTAFGHLLGWRSTFWAVTVIGVAAAAALVAWLPK
AIPMQAGSILREFRAIGAAQVQLALLISTLASVSMFTVFTYIAYILRDVTGFTAQQESMV
LLLFGAGITVGGLAGGKLADWKLMPALASLLAAVAVVQLVFSWTSHFPVPTLFTLFAWGM
VSFAVVPATQVRVLDKAKGAPNLASTLNQGAFNLGNATGAWLGGLMISAGLPLTQLPWLG
AAVAALALLAVGVSASLDRGGRVAA