Protein Info for RR42_RS27375 in Cupriavidus basilensis FW507-4G11

Annotation: NAD(P)H-quinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 TIGR01755: NAD(P)H:quinone oxidoreductase, type IV" amino acids 4 to 203 (200 residues), 321.5 bits, see alignment E=1.2e-100 PF00258: Flavodoxin_1" amino acids 7 to 130 (124 residues), 36.8 bits, see alignment E=6.6e-13 PF02525: Flavodoxin_2" amino acids 13 to 151 (139 residues), 35.2 bits, see alignment E=1.7e-12 PF03358: FMN_red" amino acids 17 to 148 (132 residues), 53.7 bits, see alignment E=2.7e-18

Best Hits

Swiss-Prot: 77% identical to PNPB_PSEWB: p-benzoquinone reductase (pnpB) from Pseudomonas sp. (strain WBC-3)

KEGG orthology group: K03809, Trp repressor binding protein (inferred from 75% identity to glo:Glov_0105)

MetaCyc: 77% identical to PnpB (Pseudomonas sp. WBC-3)
2-hydroxy-1,4-benzoquinone reductase. [EC: 1.6.5.7]; p-benzoquinone reductase (NADPH). [EC: 1.6.5.7, 1.6.5.6]

Predicted SEED Role

"Trp repressor binding protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.5.6 or 1.6.5.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YLQ3 at UniProt or InterPro

Protein Sequence (206 amino acids)

>RR42_RS27375 NAD(P)H-quinone oxidoreductase (Cupriavidus basilensis FW507-4G11)
MTCRIQVVFYSMYGHVYKMAEAVAAGAREVDGAEVTLLQVPELVPDAVLEKSGAKAARAA
FAHVPVAEPDKLADADAILFGTPTRFGNMCAQMRNFLDQTGGLWMSGGLVGKVGSVFTST
ATQHGGQETTITSFHTTLLHQGMVIVGVPYAEARLLDMSQITGGTPYGASTLTAADGSRQ
PSENELAIAKYQGRHVAGIAARLAAR