Protein Info for RR42_RS27360 in Cupriavidus basilensis FW507-4G11

Annotation: CDP-6-deoxy-delta-3,4-glucoseen reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 9 to 81 (73 residues), 61.8 bits, E=7.4e-21
• PF00970: FAD_binding_6
  • amino acids 105 to 194 (90 residues), 39.2 bits, E=1.1e-13
• PF00175: NAD_binding_1
  • amino acids 206 to 309 (104 residues), 88.3 bits, E=8.3e-29

Best Hits

KEGG orthology group: K00523, CDP-4-dehydro-6-deoxyglucose reductase [EC: 1.17.1.1] (inferred from 67% identity to cti:RALTA_B1576)

Predicted SEED Role

"CDP-6-deoxy-delta-3,4-glucoseen reductase-like"

MetaCyc Pathways

• CDP-4-dehydro-3,6-dideoxy-D-glucose biosynthesis (3/3 steps found)
• superpathway of CDP-glucose-derived O-antigen building blocks biosynthesis (3/8 steps found)

KEGG Metabolic Maps

• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.1

Use Curated BLAST to search for 1.17.1.1

Sequence Analysis Tools

See A0A0C4YQU0 at UniProt or InterPro

Protein Sequence (332 amino acids)

>RR42_RS27360 CDP-6-deoxy-delta-3,4-glucoseen reductase (Cupriavidus basilensis FW507-4G11)
MSYRIHLIESQQSFDVDADESVLDGALRANVQMAHDCRFGGCATCRVRLVEGAVAYDEYP
MGLTPEEEAEGFALACQARPTSDLVISTARPGEPCAEPARHTAVIRKIAPLSADVVHLTL
ELPQAPALDYRPGQYLKIFTGDGIARSFSMASVPRDRTVDLHVRRIPGGYFTERLLAGLR
SDDQLDVELPLGGFYFRKDDYRPLVMVATGTGLAPIKSILESLMDDPDCPPVSLYWGMRT
QADLYLHEQIQAWGARLYDFQYVPVLSRADGAWSGRRGHVQHAVAADLPDLSEHAIYLCG
SPDMICDARETFLGLGASGAHIYADSFTFQHR