Protein Info for RR42_RS27340 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 38 to 62 (25 residues), see Phobius details amino acids 68 to 85 (18 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 131 to 156 (26 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 193 to 211 (19 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details amino acids 315 to 334 (20 residues), see Phobius details amino acids 354 to 372 (19 residues), see Phobius details amino acids 378 to 382 (5 residues), see Phobius details amino acids 408 to 431 (24 residues), see Phobius details amino acids 435 to 456 (22 residues), see Phobius details amino acids 459 to 483 (25 residues), see Phobius details amino acids 491 to 511 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 90% identity to reh:H16_B1883)

Predicted SEED Role

"FIG00761799: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YBI2 at UniProt or InterPro

Protein Sequence (512 amino acids)

>RR42_RS27340 membrane protein (Cupriavidus basilensis FW507-4G11)
MQHEAVIGAAHWIYLAGVAVIVLTMILRANVVVPSILGTFLVVFALTGSPVSALGGIFSA
SLVAAKELFNIFLVIAFMTALLNSLKTLRSDIRMVEPFRVVMKNGHSAFFILAGITYVIS
LFFWPTPAVPLVSAILLPAAIAAGLPPLAGAMAIAIAGQGMALSSDYVIGVAPGISAKAA
GAAVSAVVVADRALVLSIITGAIALTLAYLSMRKHIVPASGALLTHWQARAGGAVEKPEH
AGTFDKAEIARGTEHDEPLVTDANIERSLAMVALRRVKWSKCFAVVTPLAFLAVVAVMVL
PKMGSALPELKGGDAAALVGGVAALLMMLATLAAEGPRKMLDVCPEHITDGFVFAFKAMG
SVLPIAGFFFVGAGETAAQILGVSADKAPSLLFELIQAYQHMIPDNHVLVAFGVLLVGMI
TGIDGSGFAGLPLTGTLAGALGPVVGFDSATLAAIGQMGAVWTGGGTLIAWSSLIAVAGF
ARVPVLDAVRALLLPVLIGLCVSTVCAMFLWR