Protein Info for RR42_RS27280 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03401: TctC" amino acids 50 to 322 (273 residues), 282.1 bits, see alignment E=1.9e-88

Best Hits

Swiss-Prot: 33% identical to YTCB_PSESQ: UPF0065 protein in tcbD-tcbE intergenic region from Pseudomonas sp. (strain P51)

KEGG orthology group: None (inferred from 46% identity to adk:Alide2_2885)

Predicted SEED Role

"Tricarboxylate transport protein TctC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YIR5 at UniProt or InterPro

Protein Sequence (326 amino acids)

>RR42_RS27280 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MLRKWITLLAAASLTALALPARADGPAPWPQRPVRVVVPYAPGGASDVLARLLGSKLQEA
WKQPVVVENRTGAGGNIGTDNVAKSAPDGYTLLLGDLSNFVIAPVAYKNLPYDVIKDFSA
VVTLTYSPYMLLVSPQTKANSLKELVDYARAHPGKLNWATTGIGSGPHLAGLQLARKLGI
DWLYLPNKGGAQANLDVMGGQADLMFNSMVASASYVRGGKLRVLAFTSRERHPEWPNVPT
VAEAVPGFTAGGWQGMLAPAGTPPEVIRKINADVVRILQQPEIRQRLAQLGAEPVGNTPE
ATQAFVREEKTRWADLIRESGLKLDM