Protein Info for RR42_RS27085 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 TIGR00872: 6-phosphogluconate dehydrogenase (decarboxylating)" amino acids 1 to 321 (321 residues), 384.3 bits, see alignment E=1.9e-119 PF02826: 2-Hacid_dh_C" amino acids 2 to 79 (78 residues), 32.4 bits, see alignment E=1.8e-11 PF03807: F420_oxidored" amino acids 3 to 51 (49 residues), 35.6 bits, see alignment 3.6e-12 PF01488: Shikimate_DH" amino acids 3 to 43 (41 residues), 26.3 bits, see alignment 2e-09 PF03446: NAD_binding_2" amino acids 3 to 153 (151 residues), 139.4 bits, see alignment E=3.3e-44 PF02254: TrkA_N" amino acids 5 to 80 (76 residues), 25.9 bits, see alignment E=3.2e-09 PF00393: 6PGD" amino acids 185 to 302 (118 residues), 78.5 bits, see alignment E=1.8e-25

Best Hits

KEGG orthology group: K00033, 6-phosphogluconate dehydrogenase [EC: 1.1.1.44] (inferred from 75% identity to pba:PSEBR_a3123)

Predicted SEED Role

"6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44)" in subsystem Pentose phosphate pathway (EC 1.1.1.44)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YJW6 at UniProt or InterPro

Protein Sequence (322 amino acids)

>RR42_RS27085 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MQLGIIGLGRMGANIARRLLRAQHEVVVYNRSADKVQALAADGAVGVTSIEALVGELAAP
RAIWVMLPAGDTTEQMIATLADLLEPGDVIIDGGNTFYKDDIRRAGELAARQLHYVDVGT
SGGVWGLERGYCLMIGGRQEVVGRLDPLFDTLAPGYGDIPRTPGRNPANDRAERGYIHAG
PAGAGHFVKMVHNGIEYGLMQAYAEGFDILKTKAAESLPEAERFALDLADIAEVWRRGSV
VSSWLLDLTAQALASDVKLSRFSGEVADSGEGRWTIDAAVEQAVPVPVLASALFARFRSR
QDHTYGERLLSAMRFGFGGHVE