Protein Info for RR42_RS27085 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00872: 6-phosphogluconate dehydrogenase (decarboxylating)
  • amino acids 1 to 321 (321 residues), 384.3 bits, E=1.9e-119
• PF02826: 2-Hacid_dh_C
  • amino acids 2 to 79 (78 residues), 32.4 bits, E=1.8e-11
• PF03807: F420_oxidored
  • amino acids 3 to 51 (49 residues), 35.6 bits, 3.6e-12
• PF01488: Shikimate_DH
  • amino acids 3 to 43 (41 residues), 26.3 bits, 2e-09
• PF03446: NAD_binding_2
  • amino acids 3 to 153 (151 residues), 139.4 bits, E=3.3e-44
• PF02254: TrkA_N
  • amino acids 5 to 80 (76 residues), 25.9 bits, E=3.2e-09
• PF00393: 6PGD
  • amino acids 185 to 302 (118 residues), 78.5 bits, E=1.8e-25

Best Hits

KEGG orthology group: K00033, 6-phosphogluconate dehydrogenase [EC: 1.1.1.44] (inferred from 75% identity to pba:PSEBR_a3123)

Predicted SEED Role

"6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44)" in subsystem Pentose phosphate pathway (EC 1.1.1.44)

MetaCyc Pathways

• pentose phosphate pathway (8/8 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• pentose phosphate pathway (oxidative branch) I (3/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Glutathione metabolism
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.44

Sequence Analysis Tools

See A0A0C4YJW6 at UniProt or InterPro

Protein Sequence (322 amino acids)

>RR42_RS27085 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MQLGIIGLGRMGANIARRLLRAQHEVVVYNRSADKVQALAADGAVGVTSIEALVGELAAP
RAIWVMLPAGDTTEQMIATLADLLEPGDVIIDGGNTFYKDDIRRAGELAARQLHYVDVGT
SGGVWGLERGYCLMIGGRQEVVGRLDPLFDTLAPGYGDIPRTPGRNPANDRAERGYIHAG
PAGAGHFVKMVHNGIEYGLMQAYAEGFDILKTKAAESLPEAERFALDLADIAEVWRRGSV
VSSWLLDLTAQALASDVKLSRFSGEVADSGEGRWTIDAAVEQAVPVPVLASALFARFRSR
QDHTYGERLLSAMRFGFGGHVE